SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1A488 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1A488
Domain Number 1 Region: 320-478
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.49e-27
Family HD domain 0.022
Further Details:      
 
Domain Number 2 Region: 216-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1A488
Sequence length 528
Comment (tr|C1A488|C1A488_GEMAT) Ribonuclease Y {ECO:0000256|HAMAP-Rule:MF_00335, ECO:0000256|SAAS:SAAS00548727} KW=Complete proteome; Reference proteome OX=379066 OS=100505). GN=GAU_1871 OC=Gemmatimonas.
Sequence
MGELSLAALTGALGMVAAVIAFVFGRRSGRQAEIGEQQRAKATAEDTAGRILDEARREAD
TLRKGAIVSGKEEVLQLRETHEQEFRQRRVDVEREEKRILERESQVDRVREGLEGRELEV
QRRGKELTQREDAATARSLELDTLFADERRRLEQIAGLSADQAKAELVRRLEDEALADAA
SRLREIRESAKRNADREARKIVALAVQRVAAETTAETTVSAVALPNDEMKGRIIGREGRN
IRAFELATGVDVIIDDTPDTVVVSCFDPVRRETARLALEKLVSDGRIHPGRIEEVVAKAR
REVEVAIVETGEQAAYEVGITGLHPELIKLIGRMKWRTSYGQNILAHSKEVAWLAGMMAA
ELGLDVALAKRGALLHDIGKVLTHEHEGTHVQLGVEMATKYGENPLVVNCIAAHHDDVPH
ESEVSVLVQAADGISGSRPGARREAFETYVKRLEGLERIASSYRGVERVFAIQAGREVRV
VVTPEQVDDLRMAALSEEIARRIESELQYPGQIKVVVIRESRAVDFAR
Download sequence
Identical sequences C1A488
WP_012683360.1.17207 gi|226227277|ref|YP_002761383.1| 379066.GAU_1871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]