SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1BXR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BXR4
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000215
Family Pyrin domain, PYD 0.013
Further Details:      
 
Domain Number 2 Region: 104-189
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000132
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1BXR4
Sequence length 192
Comment (tr|C1BXR4|C1BXR4_ESOLU) Apoptosis-associated speck-like protein containing a CARD {ECO:0000313|EMBL:ACO13817.1} OX=8010 OS=Esox lucius (Northern pike). GN=ASC OC=Esociformes; Esocidae; Esox.
Sequence
MSKTVSDAIINVLDGLGEAGLKRFRRKLCDCKRDQGPVIRFGKVEKADADDLVLILIRTY
TENGALDVAIEVLEAIGDKESAEELMDFQKSRNKSPGPSVPGDPGQHFVDLYRKDLIERV
SQVDPILDSLLQRKVIQQSAYSDVRSERTSQKRMRELYEGPVKGFGVSGKDIFLEILTEH
EPYLISDLKGEK
Download sequence
Identical sequences C1BXR4
NP_001297954.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]