SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1D2B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1D2B8
Domain Number 1 Region: 9-55,204-431
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.77e-32
Family FolH catalytic domain-like 0.04
Further Details:      
 
Weak hits

Sequence:  C1D2B8
Domain Number - Region: 90-224
Classification Level Classification E-value
Superfamily PA domain 0.00112
Family PA domain 0.0056
Further Details:      
 
Domain Number - Region: 501-549
Classification Level Classification E-value
Superfamily Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 0.00497
Family Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1D2B8
Sequence length 590
Comment (tr|C1D2B8|C1D2B8_DEIDV) Putative peptidase {ECO:0000313|EMBL:ACO47557.1} KW=Complete proteome; Reference proteome OX=546414 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923). GN=Deide_1p01240 OC=Deinococcaceae; Deinococcus.
Sequence
MLRAEERQLLDAVTLDRPWELITTFSTLKREHPNDVRRAAEHIERHLRELGIPVEIHQPE
LFLSLPGQASVSVGGTTFSAKPMAMSAIFPEGLTAPLVYQPSQYAANADDMFSSSLLDGE
VDVAGKIVVTEGFGMPGKIRELEHRGALGVIAINPGARAHWGICTSIWGTPDLHDLPRKP
RVAVANVNRPDGDRLIDLARAGAEAVFKTNLEEGWFVSPVPVVTIPGTEDPKSFVLLHGH
YDSWDYGVGDNAVGDATLLEVARNLWNNRAQLRRSVRIAWWPGHSTGRYAGSTWFADHFA
LELYRNCIAQINCDSPGCRWATEYKDVSVMAEATAWAGDIIRDVTGQDMQAERPVRAGDY
SFNNIGLSGFFMLLSTMPDDLRAEKDYYAVGGCGGNIAWHTEDDTLEVADRDILLKDIKI
YLLSAYRTANQTIIPFDYVQTLNEFDQTIAEYGEGIGTAVDLGRVRDAVETLRTDVRELM
RAARSLNGESLTSPQVRRVNFALITVARHLVQANYTRSPAFFHDPAEHVPPLPDLAVLQT
LQSADDYQRGFILTHATRGLNRLLAHLGDAQVAVRDALNHLELPVKGGTS
Download sequence
Identical sequences C1D2B8
gi|226357571|ref|YP_002787311.1|NC_012527 gi|226357571|ref|YP_002787311.1| 546414.Deide_1p01240 WP_012694680.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]