SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1EF34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1EF34
Domain Number 1 Region: 9-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.3e-36
Family PAPS reductase-like 0.007
Further Details:      
 
Domain Number 2 Region: 252-378
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000874
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1EF34
Sequence length 381
Comment (tr|C1EF34|C1EF34_MICCC) Uncharacterized protein {ECO:0000313|EMBL:ACO67023.1} KW=Complete proteome; Reference proteome OX=296587 OS=green alga). GN=MICPUN_87762 OC=Mamiellales; Mamiellaceae; Micromonas.
Sequence
MQAPPTNIDWDALDSQFQDNTVVQIMDKALELFGDGLAIAFSGAEDVALIQYAKLTGRPF
RVFSLDTGRLNPETYQLFDDVEKHFDIKIEFTFPDEDAVTKLVNEKGMFSFYEDGHKECC
GVRKVQPLRKKLKTLNAWVTGQRKDQSPGTRMAVPAVQVDPVFEGAAGGAGSLVKFNPLT
NATSQEVWDFLRVMGTPVNKLHEMGYVSIGCAPCTRAVLPGQQEREGRWWWEDSAMKECG
LHSGNLTAEQQAKQDAREATEEDIFNEVTAVDHAAIDALRVEPTHSKTTLAVLYAPWCPF
CQAMVAGYEEAAASFAAKGVDVVKFRADGDEKEWSKENLELKSFPTVLLFPEGRGGFVKL
GSERRDPDSLNIFVESIVGKL
Download sequence
Identical sequences C1EF34
XP_002505765.1.63511 jgi|MicpuN2|87762|e_gw2.13.168.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]