SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1KAQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1KAQ5
Domain Number 1 Region: 9-194
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.77e-33
Family Aclacinomycin methylesterase RdmC 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1KAQ5
Sequence length 218
Comment (tr|C1KAQ5|C1KAQ5_ECOLX) Streptothricin acetyltransferase {ECO:0000313|EMBL:ACO24446.1} OX=562 OS=Escherichia coli. GN=sat OC=Enterobacteriaceae; Escherichia.
Sequence
MKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFCSQLAKMGRYVIRYDHR
DTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVGMSLGGFLSQLVALKYPKRVK
SLTLIASERLADADPDMPAFDPAIIEYHQRAESLDWSDRDAVVAYQVGAWRINSGTAHAF
DAEKIQNIAELNFDRTPNILTTFNHTTLGGGERWLGRL
Download sequence
Identical sequences C1KAQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]