SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2MK93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C2MK93
Domain Number 1 Region: 6-178,207-298
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.77e-50
Family Proline iminopeptidase-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2MK93
Sequence length 298
Comment (tr|C2MK93|C2MK93_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EEK45085.1} KW=Complete proteome OX=526973 OS=Bacillus cereus m1293. GN=bcere0001_20020 OC=Bacillus cereus group.
Sequence
MIEAGKYMHIRGKKLYVETHGNPKNKPVLYLHGGPGESCYDFSFHQAERLKDSLYVIMID
QRGVCRSEEITEDEDFGLKDLIEDCEELKKVLQIEKWSVIGHSFGGYVALLYASIYPSSI
EKIIFEGPTFDFALTSRALLQKTADLLKKYGKEEVAKACLFYSSSNACSEELLEAYIRLS
DELEEKRMEIYNNKEDETDESLYSDEEWEEFSNRSKIHFDRLKLEGACHTSLLSKIKDVQ
NPMLLIVGKDDVVTCEKQIEIFNKDARNGKYIVFEESGHSPHYEEANRFAETVIHFLK
Download sequence
Identical sequences C2MK93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]