SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3MU27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3MU27
Domain Number 1 Region: 75-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 
Weak hits

Sequence:  C3MU27
Domain Number - Region: 16-61
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0964
Family Eukaryotic type KH-domain (KH-domain type I) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3MU27
Sequence length 186
Comment (tr|C3MU27|C3MU27_SULIM) KH type 1 domain protein {ECO:0000313|EMBL:ACP37061.1} KW=Complete proteome OX=427317 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1). GN=M1425_0170 OC=Sulfolobus.
Sequence
MFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPKGQNQYEAFKAVSVIRAIG
LGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRIIGEGGKAKRIIQEYTGVDI
SIYGHHIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLGRKGIN
EIKSNR
Download sequence
Identical sequences C3MU27 C3N0N9
gi|227826580|ref|YP_002828359.1| gi|229583744|ref|YP_002842245.1| 427317.M1425_0170 427318.M1627_0170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]