SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3NED4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NED4
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily Prefoldin 3.14e-25
Family Prefoldin 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3NED4
Sequence length 126
Comment (sp|C3NED4|PFDB_SULIY) GimC subunit beta {ECO:0000255|HAMAP-Rule:MF_00307} KW=Complete proteome OX=439386 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1). GN=YG5714_1406; OC=Sulfolobus.
Sequence
MAEKLPPEVQAQLAKFQQLKDQLDRLLLEKSTIENELREINKVLEELSVLNADATIYKIV
GNLLVKSDKTSVEKELNDRKELLELRSRTYQKQESILRKQLEDLQAKINEMLSKYYPQGG
QTGIKA
Download sequence
Identical sequences C3MQ51 C3MVG9 C3N5R8 C3NED4 C3NHB8 C4KHE7 D2PC62 F0NF66 F0NM23 M9U9D6
419942.YN1551_1437 426118.M164_1405 427317.M1425_1411 427318.M1627_1461 429572.LS215_1506 439386.YG5714_1406 gi|227827682|ref|YP_002829462.1| gi|229579197|ref|YP_002837595.1| WP_012711409.1.100559 WP_012711409.1.13477 WP_012711409.1.27011 WP_012711409.1.27461 WP_012711409.1.34992 WP_012711409.1.44962 WP_012711409.1.47130 WP_012711409.1.48461 WP_012711409.1.52267 WP_012711409.1.60638 WP_012711409.1.66823 WP_012711409.1.67233 WP_012711409.1.68242 WP_012711409.1.74483 WP_012711409.1.83431 WP_012711409.1.84481 WP_012711409.1.89621 WP_012711409.1.90709 WP_012711409.1.91160 WP_012711409.1.97021 gi|229584886|ref|YP_002843388.1| gi|227830379|ref|YP_002832159.1| gi|385773354|ref|YP_005645920.1| gi|284997885|ref|YP_003419652.1| gi|479325668|ref|YP_007865723.1| gi|238619853|ref|YP_002914679.1| gi|229582051|ref|YP_002840450.1| gi|385775992|ref|YP_005648560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]