SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3NG19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NG19
Domain Number 1 Region: 22-151
Classification Level Classification E-value
Superfamily Nqo5-like 1.1e-39
Family Nqo5-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3NG19
Sequence length 164
Comment (tr|C3NG19|C3NG19_SULIN) NADH (Or F420H2) dehydrogenase, subunit C {ECO:0000313|EMBL:ACP48137.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_1030 OC=Sulfolobus.
Sequence
MSEALKSLINDLQTKFKCQAKIENDRRITVIVPDKKIMKDVANHLKNFGFDHVKAVTGID
YPEQEKLEVVYHISSYSNLDLAKIILALRITVTYKDPSLPSLYSIFESAWIGERETYEML
GIRFEGHPDLRRFFLDEDFEGVYPLRKSFKIKLEGIFVDKPTTE
Download sequence
Identical sequences C3NG19
gi|229581660|ref|YP_002840059.1| WP_012717312.1.52267 419942.YN1551_1030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]