SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3NHB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NHB4
Domain Number 1 Region: 2-41,164-345
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.65e-23
Family FolH catalytic domain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3NHB4
Sequence length 488
Comment (tr|C3NHB4|C3NHB4_SULIN) Uncharacterized protein {ECO:0000313|EMBL:ACP48524.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_1433 OC=Sulfolobus.
Sequence
MLLQHLKTLSNYGEIITGSKNEIKLVREIRKMLEDNSDEIRQIPIRVLNWEQKELIFECE
SKTIDAISLPYSLSTEVEADVADNFKECNGRKLMKIRIKNLYEINKLYIEAVENDCLGII
FSLNNEKRKFVIKYGDLLSHQPSYPPPIPAFYIKENDFPYIKGRCRISLKTDINPFATGY
IIEAIRNSKNENKIIHITAHHDHWFKGERDNLLAVALLREFRSNVYETHLISFTAEESGS
LNFSTFSWSHGSREFLKNYKNTDDILLNINMDNISEESLILKAVPGLLELSRKYFKNVVE
SPEIYSDGYSYIKVGIPSITIESLGNIHYHGEYDVIENDKSNAFLNASTILDIINRIINE
NIEYKTREMKEELKKDLVELPAELKSYLVNVEDLLDKNYMEAYREIVKLYGGILELNQPY
STVELFHKIKGLKIARKNDVCIEDLGCIKRLRNDEIFYRFYLYYINELKESITTEYINKI
YFVLKKFF
Download sequence
Identical sequences C3MQ55 C3NHB4 D2PC66 F0NF70 F0NM27
gi|227830383|ref|YP_002832163.1| gi|385775996|ref|YP_005648564.1| gi|229582047|ref|YP_002840446.1| WP_012713732.1.27011 WP_012713732.1.34992 WP_012713732.1.52267 WP_012713732.1.66823 WP_012713732.1.67233 WP_012713732.1.91160 419942.YN1551_1433 429572.LS215_1510 gi|284997889|ref|YP_003419656.1| gi|385773358|ref|YP_005645924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]