SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3NJY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3NJY9
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000121
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3NJY9
Sequence length 102
Comment (tr|C3NJY9|C3NJY9_SULIN) Zinc finger C2H2-type domain protein {ECO:0000313|EMBL:ACP47391.1} KW=Complete proteome OX=419942 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2). GN=YN1551_0202 OC=Sulfolobus.
Sequence
MLYVSLRAVYKWVCPICLTPFETYQAFIMHLRYEEKEKTCRYCGKTFANTDGLLDHIGKK
HVWLPWGRHKERGGDGDPTTTLNPSKSYAICSILDNHSAYLR
Download sequence
Identical sequences C3NBN3 C3NJY9
419942.YN1551_0202 439386.YG5714_2693 gi|229580440|ref|YP_002838840.1| gi|229580914|ref|YP_002839313.1| WP_012716755.1.13477 WP_012716755.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]