SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3Y003 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3Y003
Domain Number 1 Region: 294-391
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 455-740
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.83e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.024
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000231
Family I set domains 0.053
Further Details:      
 
Domain Number 4 Region: 19-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000347
Family Ovomucoid domain III-like 0.018
Further Details:      
 
Domain Number 5 Region: 130-194
Classification Level Classification E-value
Superfamily EF-hand 0.00000000198
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3Y003
Sequence length 803
Comment (tr|C3Y003|C3Y003_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN66369.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_209223 OC=Branchiostoma.
Sequence
MYSVAVDKEYEIDACSETFCGPGRHCRVSPESGDAECVCLDACRPHKKPVCGNDGKLYPN
HCELHRMACVLKKRIAIAHNKDCFYQGDNCTDEEYEKLKTQLLRLQNRKFAQSPDAQGLG
QDELSIKKFLVTMMFEYWDLDNDGQVSSNEMGQVMRKEDELAEVLTTCSLYDLLKFDDIN
DDHRVDIDEFYNAFGVTPVHLSDEKKSLVTVAKVGDSLALRCDITGDPEPILVWQRHGVD
LTTIDLMTLNIDFSGYIFQVFDDGTLYITSLSTLHMGNYSCRALHNGQVVQVHTVKVQVP
PSTKVSPRRQAHSPGSTAELKCHAEGIPTPAVKWLKNGGNLDPSESPHVSLQDSGSVLHI
SNVRTEDMGAYICHAENLVGSSEDISTLFVQDGGHFSSLQLESVFYVFHDDGVNIFQPGT
CQLVHHIKASDKILATQEPVCTPDMDGECNQVCSWGSAVNVLDTYIYVSQPQENRVLVLE
TRTQQVIQVIQTDPLPVDLQYMEELDQVWVLNWGDMERSFQTLEVIREASAAVTHRTIHT
EPVENHFDHVESFFLPPVKMLEQNFKYAYLVHRDQPKIDKMDVETMKYVRTIDLTEQNCH
PQSLAFSPVSGYVVVQCSGIRDDQRHNVDDDSQVLLDALTDAVIQVNPEIHGKPHVSPDG
RYIVSIDNESELIVVQSISEDGQLSLSFEVHTNLHVSDVAFHPTSGFNSYNLYVSSESKT
DILFVNLLNGKVKMIKGVKSAMPVEHWPWDESNRAIISTGLFGNYLVSPSEEAIFVVDSK
LDKVNCEIDQVKHGNVIVWVGEL
Download sequence
Identical sequences C3Y003
XP_002610359.1.56174 7739.JGI209223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]