SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3Y2E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3Y2E9
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000000144
Family Calponin-homology domain, CH-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3Y2E9
Sequence length 59
Comment (tr|C3Y2E9|C3Y2E9_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN65504.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_182059 OC=Branchiostoma.
Sequence
QIYTDWANHYLERAGHKRLVRDLQKDITDGVLLATIIEVVANEKIQDINPKPKSQSQMV
Download sequence
Identical sequences C3Y2E9
XP_002609494.1.56174 7739.JGI182059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]