SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3Y9L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3Y9L9
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.53e-30
Family Acetylcholinesterase-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3Y9L9
Sequence length 164
Comment (tr|C3Y9L9|C3Y9L9_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN63275.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_88213 OC=Branchiostoma.
Sequence
MASGCGTLLLVWALLLFYGVTNTSSSSSPVMTKYGQVRGITVTPARDLKPVIQYLGIPFA
LPPKGSLRFRPPQPPKPWTNVRNCTTFAPVCPQMINDTENWLKQGASVQRMRLAMLPFLK
LMDEDCLYLNVYKRADLDKSSSRPFQTITRRTLPYYGWVVVTNP
Download sequence
Identical sequences C3Y9L9
7739.JGI88213 XP_002607265.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]