SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3YVB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3YVB7
Domain Number 1 Region: 40-65
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000798
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily Sema domain 0.0000000693
Family Sema domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C3YVB7
Sequence length 66
Comment (tr|C3YVB7|C3YVB7_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN55833.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_205823 OC=Branchiostoma.
Sequence
YEDLTVVANSAVLPSMYFTQDKNYIYVATQRQVTLVPVENCGQYSTCGECLGVRDPYCGW
CVLDNK
Download sequence
Identical sequences C3YVB7
XP_002599821.1.56174 7739.JGI205823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]