SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3Z445 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3Z445
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-32
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C3Z445
Sequence length 115
Comment (tr|C3Z445|C3Z445_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN52658.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_219092 OC=Branchiostoma.
Sequence
LVKRERGGSKRNALLKWCQRKTQGYTGIDVTNFSTSWNDGLSFCALLHSYLPEKVPFSEL
TAQNKRKNFTTAFQAGESVGIPTMLSADELVQTERPDWQAIMAYVTAIYAKFENV
Download sequence
Identical sequences C3Z445
7739.JGI219092 XP_002596646.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]