SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3ZNN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C3ZNN6
Domain Number 1 Region: 3-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 39-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 83-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 4 Region: 164-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  C3ZNN6
Domain Number - Region: 133-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0109
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3ZNN6
Sequence length 201
Comment (tr|C3ZNN6|C3ZNN6_BRAFL) Uncharacterized protein {ECO:0000313|EMBL:EEN45888.1} KW=Complete proteome; Reference proteome OX=7739 OS=Branchiostoma floridae (Florida lancelet) (Amphioxus). GN=BRAFLDRAFT_235851 OC=Branchiostoma.
Sequence
MRDIVQCRDLKGCVKISKVCDGNMDCSDGSDEVNCDALCESIGYWPCRSTLPPFAKCISR
QERCDGYVDCRDFSDEIGCGNVYQWKCPGENTCLPESFLCDTIQHCANGEDEKNCEEVSC
LGTACESTFKCGAVMLDMDTCDGVPDCLDVTEEKNCGRITMFSNRLPCIRSNRFISRDNI
CDGIPDCVDASDEDVCAGKRF
Download sequence
Identical sequences C3ZNN6
XP_002589877.1.56174 7739.JGI235851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]