SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4LYJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4LYJ2
Domain Number 1 Region: 81-217
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-23
Family PWWP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4LYJ2
Sequence length 335
Comment (tr|C4LYJ2|C4LYJ2_ENTHI) Uncharacterized protein {ECO:0000313|EMBL:EAL51892.1} KW=Complete proteome; Reference proteome OX=5759 OS=Entamoeba histolytica. GN=EHI_094010 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEEEKQVDTTTVQSSTPPMSPQHSHSITPSASPKENKVSTPLSPNKEDGSVATPTSRKKE
EETKPKKSPNDSVTVIDKEIEQNKWDNWTVVWVKQKGYPWWPAKIIIMDKLNEKTKGQLE
KLIEFKKDKKYLVKYITNGYQFGWVNDNQIKPFKEEFMNIITERMLGKKDVIESINKAIE
ITNDKISENDIDKFHKAVIKKEKQMEEEEKKKEKMRNCDIGFMVVNDPLIEITKIEGIVE
KSIENNNSSLQKLKNWKEMDHSQVIEELNTLMKEPIMIHEIINPINKIGELLNSICQSTN
IEISVLAERVLERIKKELKYAIISGEYQRCKEIFN
Download sequence
Identical sequences A0A175JJJ0 C4LYJ2 M3UZS9 M7W3R8 N9TPU7
jCVI|EHI_094010 gi|56474527|gb|EAL51892.1| gi|67484098|ref|XP_657269.1| XP_657269.1.49425 294381.C4LYJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]