SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4PF87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4PF87
Domain Number 1 Region: 1-80,112-125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.76e-25
Family Duffy binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4PF87
Sequence length 125
Comment (tr|C4PF87|C4PF87_PLAFA) Var DBLalpha {ECO:0000313|EMBL:ACR19490.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ADIGDIIRGRDLYRRDKGKREKLEEKLKQYFKNIYDKLGDEAKDRYKDDAPDFFKLREDW
WSLNRETVWKAMTCSADTGNAYFRATCGDNEKNATRAKDICRCPKSSGANANQVPTYFDY
VPQYL
Download sequence
Identical sequences C4PF87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]