SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4XV99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4XV99
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-40
Family Galectin (animal S-lectin) 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4XV99
Sequence length 142
Comment (tr|C4XV99|C4XV99_PANTR) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0030424 OC=Catarrhini; Hominidae; Pan.
Sequence
MSFLTVPYKLPVSLSVGSCVIIKGTPIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGR
RVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCHNEYEVKVNGEYIYAFVHRIPPSY
VKMIQVWRDVSLDSVLVNNGRR
Download sequence
Identical sequences C4XV99 C4XVA2
ENSPTRP00000043424 ENSPTRP00000043424 XP_002829258.1.23681 XP_003812277.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]