SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YFK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YFK6
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.03e-25
Family Thioltransferase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4YFK6
Sequence length 119
Comment (tr|C4YFK6|C4YFK6_CANAW) Glutaredoxin {ECO:0000313|EMBL:EEQ43087.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_01324 OC=Candida/Lodderomyces clade; Candida.
Sequence
MFRTLLTKRLFNTSTMVSSQVKNKVEQLIKTKPVFIASKSYCPYCKATKSTIEAITKDAY
ILELDEVDDGAEIQEALLEITGQRTVPNVFIGGQHIGGNSDVQALKSSDKLDDKIKAAL
Download sequence
Identical sequences C4YFK6 Q5ABB1
CAWT_01324 CA4919 5476.CAL0005151 XP_719021.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]