SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YFQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YFQ1
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.73e-23
Family Putative serine hydrolase Ydr428c 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YFQ1
Sequence length 267
Comment (tr|C4YFQ1|C4YFQ1_CANAW) N-formylkynurenine formamidase {ECO:0000256|HAMAP-Rule:MF_03014} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_00027 OC=Candida/Lodderomyces clade; Candida.
Sequence
MEDISEEQEFKYGEHSLQKIKVFKYSSTNASTYIYIHGGAWRDPSNTFDEMRPVLGIPNA
NLIGINYRLSPEIKHPEHLIDILRALRFVKQNFDVSQITLLGHSVGATMILQLLHYRQII
RDGLKHTHKDDLSSLDNLFAYVNDNVLLSQVIFLDGIYDVVELLKEYPDYASFVDDAFVS
NKHFADSTQLSSANESLDLPFSLVSKDTKFLIYQSLEDDLLSMKQTHLLIDYLSSKNQGF
TLHVGNWGKHEEIFGKYREIVFSGNVP
Download sequence
Identical sequences C4YFQ1 Q59ZV4
5476.CAL0003841 XP_715037.1.88832 CA5360 CAWT_00027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]