SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YHK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YHK7
Domain Number 1 Region: 32-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.1e-26
Family Glutathione peroxidase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4YHK7
Sequence length 176
Comment (tr|C4YHK7|C4YHK7_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ45239.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_03554 OC=Candida/Lodderomyces clade; Candida.
Sequence
MTDGKFPTNIEPKYIPYSKDHASLTACANPIPLDLKSLFPNNTVVVTAVPGAFTPTCTEQ
HIPDYLKHLKDFKDKGVKKIIVLSANDPFVMAAWAKALGYTDEENYVIFATDPNASISKE
LGDGFVADLTSAGMGLRLQRYASIVVNGEITYLETEDSLGFSEISSAETILKRIHN
Download sequence
Identical sequences C4YHK7 Q5AF44
CAWT_03554 XP_720512.1.88832 CA4127 5476.CAL0004253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]