SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YLZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YLZ5
Domain Number - Region: 38-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00614
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4YLZ5
Sequence length 279
Comment (tr|C4YLZ5|C4YLZ5_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ43626.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_01870 OC=Candida/Lodderomyces clade; Candida.
Sequence
MRLNVVIRFTNSLSASEQVPDLSIPLSINYDVDDVNKLVNVVWLKTTIRSKVPQCANKRL
RLIYNGRVLNEKTDFKKEVLKPQLNLDQIYIHCVIGDELTREQLAQENQLDNKPQEVSTN
PEVIGFDRLLQQGFSQDDVTDLRRQFLSIYGSDNTSSGGDIADVEEDEHRQNRLRQLEER
WIESTSNNEAAGTANEQTPLTQDGDQAQAATTPSQPMDLDESRVNEDLLLGFCVGVFLGI
ISVVFLLADDSVFNKRQKMSIIAGLFINFSLAIVRGQWI
Download sequence
Identical sequences A0A1D8PSZ5 C4YLZ5
CA0806 5476.CAL0005814 CAWT_01870 XP_710162.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]