SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YM72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YM72
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.65e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 89-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.28e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4YM72
Sequence length 215
Comment (tr|C4YM72|C4YM72_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ43703.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_01950 OC=Candida/Lodderomyces clade; Candida.
Sequence
MTLTLYTAPTGNGRKPLVFLKLLNIPHELHLFSWPTKDIKQDWYLKLNPQGLVPTLVDGE
LILPESNAILQYLAETYDKQGKFSYNLQTDPLEYWQQQKWLFYQATQFAGTLFRFNTYIG
IKADDGKVWDNILQSFADAYKVIDETLAQSEWFVGDKFTIVDIAFGVGNHRRIEVVARLG
LDKHFQDYDTKYPHVAQWYKKFLEVEGIKKALALK
Download sequence
Identical sequences C4YM72
CAWT_01950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]