SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YQB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YQB6
Domain Number - Region: 2-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00134
Family Thioltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YQB6
Sequence length 78
Comment (tr|C4YQB6|C4YQB6_CANAW) Glutaredoxin-like protein {ECO:0000256|RuleBase:RU363082} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_02673 OC=Candida/Lodderomyces clade; Candida.
Sequence
MLCSNAKFILYDALKSPKLKNMPIKLTTIDIMDPKNQEAFDKYCYDVPVLHVDRPNQAKP
VKFMHYFYEDKLLEEFTK
Download sequence
Identical sequences A0A1D8PJN7 C4YQB6
5476.CAL0004673 CAWT_02673 CA3389 XP_720014.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]