SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YSW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YSW9
Domain Number - Region: 34-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00291
Family YKR049C-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YSW9
Sequence length 222
Comment (tr|C4YSW9|C4YSW9_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ47105.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_05664 OC=Candida/Lodderomyces clade; Candida.
Sequence
MLRSIIKSFKPSASFSSSIISPKSTTSLSTSSLKPLTVYHNSNLLVSHQLVAKLNNFNST
TDSPTNNKITFNLKTNEQLSESDYKFIIDECLYIHPDNKSILLQIFHNKYHMDKKKLIKD
FTLHDSIFEYNNLINNNKSYPLIIDYNHCLIANDDASFDRIMMNYLTCGIQNTTSSNSTT
ASHGFTTNGNSSSSGNGGNNSTGTVKYNDLVHPHMAEFADLF
Download sequence
Identical sequences C4YSW9
CAWT_05664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]