SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YTR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YTR2
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-27
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YTR2
Sequence length 123
Comment (tr|C4YTR2|C4YTR2_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ47003.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_05557 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDQTKHLLNEQYPQE
SYEVINLNILDDGLTIQNQLYANTGQYMVPIIFINGQHVGGNSEVQQLHTNGKLQELLNP
QKY
Download sequence
Identical sequences A0A1D8PR08 C4YTR2
5476.CAL0003068 CAWT_05557 CA4963 XP_721348.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]