SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YTR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4YTR3
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-30
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YTR3
Sequence length 156
Comment (tr|C4YTR3|C4YTR3_CANAW) Glutaredoxin {ECO:0000313|EMBL:EEQ47004.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_05558 OC=Candida/Lodderomyces clade; Candida.
Sequence
MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPE
LKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
TGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
Download sequence
Identical sequences C4YTR3 G1UAU6 Q5AH29
5476.CAL0003046 XP_721347.1.88832 CA4964 CAWT_05558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]