SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4YTR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YTR7
Domain Number - Region: 58-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0125
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YTR7
Sequence length 153
Comment (tr|C4YTR7|C4YTR7_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ47008.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_05562 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSTRMFITSKNKYNKKIENAIKKINKLTANPETSFKFDAERFKEIELFVYGQRPITYKPA
WGLKLFWKDNLPTLRYHNPDIQFTVNNITVESESELSKLPLKLKVHGTDQSNSFEINCTD
KPPSKILSELIEITKARKLTEEELPKLPLRPVK
Download sequence
Identical sequences C4YTR7 G1UAT6 Q5AH35
CAWT_05562 5476.CAL0003032 CA4968 XP_721341.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]