SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4Z487 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4Z487
Domain Number 1 Region: 625-686
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000245
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4Z487
Sequence length 691
Comment (tr|C4Z487|C4Z487_EUBE2) Glycoside Hydrolase Family 73 protein {ECO:0000313|EMBL:ACR71571.1} KW=Complete proteome; Reference proteome OX=515620 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48). GN=EUBELI_00558 OC=Eubacterium.
Sequence
MKSVYKCSVKRIAALAVMVCMLVLAGLAFTSVVNTKAESVIAQGHVNYDVTNLRIRKSPV
TGEIITTVDGGFKFDIYEEVNTDSGTVWYSIGFSYDGSYTRGYVTSSYTTIDKRIDYKPD
ADFEEYLNSQGFPDSYKDSLRQLHAQYPNWVFVADHNGKDWSDVVDNQNVIGRSLIHGSA
VSSWKSVADGCYDWESGEYTGLDGSWVQASSALVEYALDPRNFLNATNIFMFENLAFDGS
VQDADGLESMTDGTFMDNSSHDLSYNGRSYTYITGLLYAGQESGVSPYHLTSRILQEQGY
DGHGSSISGTQSGYSGYYNYYNIGASPSGGYTAVQNGLRYASKSDSSLLRPWNTRMKSII
GGAIFIGKSYINKGQDTLYYEKFDMTGRGHQYMTNILAPRSESVKSAQGYSDSNKESISF
VFKIPVYENMPENVCAIPTGDGSPNNRLKNLYVDGWSLTPTFSLYTTEYSFIVDYETSSV
NIGGSALDSSANVSGLGKYELSVGSNDIKITVTAANGDTQDYTITVVRQDKAPDPTPDPE
PDKPDNSVSYPGFSTNLSVDESTKYISGISVSSSVSDVLDKIKNQEGAYSKVLNKNGNEK
DGTVGTGDILITYNSSGNEVSRYEIIIYGDANGDGDIDLFDFALIKRALLGISEPSGIYW
KAADCNKDGELDLFDFAVVKRYILGIGNISQ
Download sequence
Identical sequences C4Z487
WP_012738807.1.74791 gi|238916501|ref|YP_002930018.1| 515620.EUBELI_00558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]