SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4ZBE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4ZBE6
Domain Number 1 Region: 313-509
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-42
Family Ribonuclease PH domain 1-like 0.00000929
Further Details:      
 
Domain Number 2 Region: 24-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-42
Family Ribonuclease PH domain 1-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 159-251
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.76e-24
Family Ribonuclease PH domain 2-like 0.0053
Further Details:      
 
Domain Number 4 Region: 470-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.74e-23
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 578-663
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.07e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 641-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.76e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 260-339
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000207
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4ZBE6
Sequence length 718
Comment (tr|C4ZBE6|C4ZBE6_AGARV) Polynucleotide phosphorylase {ECO:0000256|HAMAP-Rule:MF_01595} KW=Complete proteome; Reference proteome OX=515619 OS=KCTC 5835 / VPI 0990) (Eubacterium rectale). GN=EUBREC_1935 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MYCLVVSEEEYTSAKEFLRRINMYKSYSMELAGRTLTVDIGRVAAQANGAVFIKYGDTTV
LSTATASDKPRDGVDFFPLSVEFEEKMYSVGKIPGGFNKREGKASENAILTDRVIDRPMR
PLFPKDYRNDVTLNNLVMSVDPECRPEIVAMIGTALAVHISDIPFDGPCAMTQMGLVDGE
FIVNPSQKQWDEGDLQLTVASTKEKVIMIEAGANEIPEDQMIEAIYKCHDINQTVIAFMD
QIRDEIGKPKHEYESCAIPEQMFEDIKKIVTPEQMEEAVFTDEKQKREENIRAITEQLEE
AFADNEEYLAVLGEAIYQYQKKTVRKMILKDHKRPDGRAINQIRPLAAEVDLIPRVHGSA
MFTRGQTQICDVVTLAPLSEIQKIDGLDANITTKRYMHHYNFPAYSVGETKVSRGPGRRE
IGHGALAEKALVPVLPSIEEFPYTIRAVSETFESNGSTSMASTCASCMSLMAAGVPIKAM
VAGISCGLVTGDTDDDFLVLTDIQGLEDFFGDMDFKVTGTHKGITAIQMDIKIHGLTRPI
VEEAIARTREARLYIMDEVMSKAIAEPRKEVNEWAPKIEQITIDPSKIGDVVGQKGKTIN
EIIDRTGVKIDITDDGAVSVCGTDKEMIAKAIDMIKIITTDFEQGQILEGTVVSIKEFGA
FIEFAPGKEGMVHISKIAKERINRVEDVLTLGDKVKVVCLGKDKMGRISFSMKDVKED
Download sequence
Identical sequences C4ZBE6
515619.EUBREC_1935 gi|238924296|ref|YP_002937812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]