SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5A3V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5A3V2
Domain Number 1 Region: 13-42
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000942
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5A3V2
Sequence length 62
Comment (tr|C5A3V2|C5A3V2_THEGJ) Zn-finger protein, C2H2 type {ECO:0000313|EMBL:ACS32914.1} KW=Complete proteome; Reference proteome OX=593117 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3). GN=TGAM_0412 OC=Thermococcus.
Sequence
MVELKAITFIDRDGELYYRCPRCGMVFRKSRDYIRHVNKAHGWLFRGGRPKGKRALKKLG
KE
Download sequence
Identical sequences C5A3V2
593117.TGAM_0412 WP_015858032.1.60195 gi|240102469|ref|YP_002958778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]