SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5A5E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5A5E0
Domain Number 1 Region: 26-270
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.9e-50
Family Biotin biosynthesis protein BioH 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5A5E0
Sequence length 279
Comment (tr|C5A5E0|C5A5E0_THEGJ) Lysophospholipase, putative {ECO:0000313|EMBL:ACS33452.1} KW=Complete proteome; Reference proteome OX=593117 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3). GN=TGAM_0950 OC=Thermococcus.
Sequence
MRILTFFRSNGFGWVVEMGVYKVKFGEPELGWVVLVHGLGEHSGRYGRLIRELNEAGFAI
YAFDWPGHGKSPGKRGHTSVEEAMEIIDSIIEELGEKPFLFGHSLGGLTVVRYAETRPDK
IRGVIASSPALAKSPETPGFMVALAKFLGRVAPGLVLSNGIRPELLSRSRDAVRKYVEDP
LVHDRISAKLGRSIFVNMELAHREAERIRVPVLLLVGTADIITPPEGARKLFKRLKVEDK
TLREFEGAYHEIFEDPEWADEFHRAIVEWLVERVRNKPR
Download sequence
Identical sequences C5A5E0
gi|240103007|ref|YP_002959316.1| 593117.TGAM_0950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]