SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5TAG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5TAG9
Domain Number 1 Region: 20-182
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.83e-29
Family Bacterial lipase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5TAG9
Sequence length 217
Comment (tr|C5TAG9|C5TAG9_ACIDE) PGAP1 family protein {ECO:0000313|EMBL:EER58523.1} KW=Complete proteome; Reference proteome OX=573060 OS=Acidovorax delafieldii 2AN. GN=AcdelDRAFT_3899 OC=Comamonadaceae; Acidovorax.
Sequence
WRQPFRHDAVPDWLPPLPPGQTPRRGVVLVHGFLCNRGFWLPWMAALRERGHAHVAVTLE
PAFGSIDDYAATLDAAVQRVTQATGMAPVVVGHSMGGLVARAWLRTLPAQAAATRVHRVI
TLGTPHGGTWAGRFSRAVNGRQMSLAGEWVGALQRAEPAERAALFTCWYSNCDNIVFPAS
TAALPGADNRFVEGLAHMQMAFDPRVMQACLEEMGRE
Download sequence
Identical sequences C5TAG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]