SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5UVJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5UVJ4
Domain Number 1 Region: 19-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000051
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5UVJ4
Sequence length 151
Comment (tr|C5UVJ4|C5UVJ4_CLOBO) Uncharacterized protein {ECO:0000313|EMBL:EES47992.1} KW=Complete proteome OX=536233 OS=Clostridium botulinum E1 str. 'BoNT E Beluga'. GN=CLO_2150 OC=Clostridium.
Sequence
MENITLNRLKKAGWTNERNINIDLIEKTFKEKSINMPEKIRVFLQKYGMLEIKFKRKMQA
IAIDEVIEFNPIKAIGDNLDSEYFMEIFDEYDIDDVVYPIGIANRGNLLMLMTENETFYR
YTDGFLCKDGENIEEMLDCVVGECKEPIYFE
Download sequence
Identical sequences A0A0L9YD46 C5UVJ4
WP_003369234.1.10246 WP_003369234.1.14003 WP_003369234.1.14250 WP_003369234.1.49945 WP_003369234.1.65636 WP_003369234.1.73899 WP_003369234.1.92433 WP_003369234.1.92626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]