SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5WS35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5WS35
Domain Number 1 Region: 109-379,489-617
Classification Level Classification E-value
Superfamily Subtilisin-like 1.23e-84
Family Subtilases 0.0033
Further Details:      
 
Domain Number 2 Region: 372-438
Classification Level Classification E-value
Superfamily PA domain 0.0000432
Family PA domain 0.013
Further Details:      
 
Weak hits

Sequence:  C5WS35
Domain Number - Region: 35-106
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000196
Family Subtilase propeptides/inhibitors 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5WS35
Sequence length 764
Comment (tr|C5WS35|C5WS35_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EER90842.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3001G081100 OC=Sorghum.
Sequence
MRRHGEVCVIFAVAAAALLVAAATPAAAGREDRQTYIVHMSHSAMPSDFVEHEEWYAASL
QAVSDAATVLYTYNTLLHGYSARLTRAEAAALESQPGVLVVNPEVRYELHTTRTWEFLGL
DGTDALFPQSGTGSDVIVGVLDTGVWPERPSYDDTGFGPVPAGWKGKCEDGNDFNATACN
KKLIGARFFLTGYEAAKGPVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGT
AKGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTAEYYRDSIAVG
AFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVMLGNGKNYTGVS
LYSGKLLPTTPVPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNARVQKGFVV
KDAGGAGMVLANTAANGEELVADAHVLPGSGVGEKAGNAMRDYAMSDPKATATIVFAGTK
VGIKPSPVVAAFSSRGPNTVTSSILKPDVIAPGVNILAAWSGSVGPSGLPGDSRRVGFNI
ISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALMTTAYNDYPGGAGILDVATGRPATPL
DVGAGHVDPAKAVDPGLVYDITAADYIDFLCANNYEPAQIAALTRQHPSEGCSANRTYTV
TALNYPSFSVAFPAAGGTVKHTRTVTNVGQPGTYKVTASAAAGSAPVTVSVEPSTLSFSK
AGEKQSYTVSFTAGGMASGTNGFGRLVWSSDHHVVASPIAATWT
Download sequence
Identical sequences C5WS35
4558.Sb01g007310.1 4558.Sb01g013970.1 jgi|Sorbi1|5028621|Sb01g013970 jgi|Sorbi1|5048085|Sb01g007310 XP_002463844.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]