SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5X2A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5X2A2
Domain Number 1 Region: 514-760,790-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 81-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-19
Family alpha-D-mannose-specific plant lectins 0.0067
Further Details:      
 
Weak hits

Sequence:  C5X2A2
Domain Number - Region: 369-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000282
Family Pan module (APPLE domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5X2A2
Sequence length 904
Comment (tr|C5X2A2|C5X2A2_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EER96846.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3002G224400 OC=Sorghum.
Sequence
MSPLPPALPRSLAFLGLALILLPARAADAGPLTTELLRPPFTASNILYVDTDGAFLESKN
GAFKAAVWNPGQGEQQDRFYLVVLHAPSATVVWSGNRGAPTTSSGSVKLTSQGLTVSNPD
GTVLWSTPPQLPSPVVALRLLDSGNLQLLDAGNATLWQSFDNATDTLLPGQQLRAGAYLS
AATSATDLAEGNYRLGVTTADLVLTWQASTYWRLSNDVRSYKDRNAAVASVSVNASGLFA
VAADGGLVFRVDLGEAAFPVLKLGYDGRLRITSYPLVNSSAPLGSDFVAPANDCDLPLQC
PSLGLCSPSGNSSTCTCPPLFAASATTPGACTPGDGSALASPALCQSSNSTVSPAYLALK
SKAAYFATKFDPPIKTGVNHNACRGLCSTSCGCLAYFYDNSSLSCYLIQEKQLGSLYLSS
SASAMGYIKTIPSPNNATRNNSSSSSANRVVPIVLPSIAAFLLLTVIACYACWRRMRNNG
KKRKGRSPGVKQVYMGRQKDTGNADDDEDDDNVRVPGMPTRFSYAEIEAMTSNFETKIGS
GGFGSVYKGELPGVEGLVAVKKLEAVGVQAKREFCTEITVIANIRHVNLVRLRGFCAEGS
RRLLVYEYMNRGSLDRSLFGRTGPVLEWGERMEVALGVARGLAYLHTGCDQKIVHCDVKP
ENILLADGGQVKVADFGLAKLMSPEQSALFTTMRGTRGYLAPEWLSNAAISDRADVYSFG
MVLLELIHGRKNRGEQTNDGVAAAVAVAVAGSSVHSDWPSGWSSATAVSSPSGASGSGDE
YFPMVAMELHGQGRHLDLVDPRLEGRVEEAEAARAVRIALCCLHEDPAQRPSMAAVVRML
EGTVAPPEPRVEALGFLRLYGRGHAVPNTSLIAMAGTSGSAGTPSSTAGVSQLTDTLQSV
SAPR
Download sequence
Identical sequences C5X2A2
jgi|Sorbi1|5033933|Sb02g026520 XP_002460325.1.57931 4558.Sb02g026520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]