SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5X5M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5X5M2
Domain Number 1 Region: 101-173
Classification Level Classification E-value
Superfamily PA domain 0.00000288
Family PA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5X5M2
Sequence length 636
Comment (tr|C5X5M2|C5X5M2_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EER99915.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3002G418300 OC=Sorghum.
Sequence
METTTAARRRRRLLLLLVLLALAAHRAAARFVVEKNSLRVTSPAALRGVYECAIGNFGMP
QYGGTMHGVVVYPKVDAKACRPFDASGLSFKPKSGGLPVFLLVDRGDCYFTTKGWNAQNA
GAAAVLVADDKVEPLITMDSPESSGTEHIENITIPSALVTKRFGDDLRKALQNGEMVNVL
LDWRESLPHPDERVEYEFWTNSNDECGAKCDMQMNFVRSFRGIAQALEKRGYTQFTPHYI
TWYCPEAFILSKQCKSQCINHGRYCAPDPEQDFSIGYDGKDVVVQNLIQICVFRVANETR
RPWMWWDYVHDFAVRCPMKEKKYTRECAHGVINSLGLDIEKINKCVGDPDADKENPVLKA
EQDAQIGHGSRGDVTILPTLVVNNRQYRGKLEKRSVLKAVCSGFEETTEPDVCLREDIET
NECLENNGGCWLDKATNVSACKDTFRGRVCECPTVNGVKFIGDGYSHCEASGLGRCQINN
GGCWNETRNGKTVSACSNQEAKGCKCPSGFRGDGMNSCEDVDECKEKLFCQCKDCACENT
WGSYECSCGGSNSLYIREHDTCISKQSSSSLGWGFLWVIFIGLALAGAGAYAVYKYRLRS
YMDSEIRAIMAQYMPLESQEMPNQHRSVVPVDHADI
Download sequence
Identical sequences C5X5M2
4558.Sb02g043010.1 XP_002463394.1.57931 jgi|Sorbi1|5052249|Sb02g043010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]