SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5XIK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5XIK1
Domain Number 1 Region: 99-188,285-307
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-24
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  C5XIK1
Domain Number - Region: 143-279
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0654
Family All0351-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C5XIK1
Sequence length 463
Comment (tr|C5XIK1|C5XIK1_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EES02080.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3003G432700 OC=Sorghum.
Sequence
MALALSLSLSLSLLLVGGVVVRAQPFDYPTAKPSTRWANTDASLPHHVTYADGSVARAAL
LRLNPAGYGPSYAFGFFCTNHQAPPCAEFLLAVAVVYCNSGGLMTSVVAGIPQVVWSANR
GQPVGEGASAELTAAGDLVLRSATGAVVWSSGTAGRSVAAMAVTRDGNLVLLDARNATVW
QSFDHPTDALLVGQSLRAGARLVANSSAANWSASRLYLTVADDSLSAYVDAKPPQRYYHL
GFSKAAGAYATYANGSLAVFDPAAAPAASTPPLATIQLPEVGAGTVQYMRLEHDGHLRLY
EWNPAGWAPVFDVLRLFPDDCAFPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVP
TAPVACGGPPARLVSLPGLAYFNDPATSLKALERVSDAACRKACLDECRCAAAQFVYGAD
AGDGFCYLQSEVLSMETSRPEVVHYNSTMHLKVRATRRPSAGF
Download sequence
Identical sequences C5XIK1
XP_002456960.1.57931 4558.Sb03g046410.1 jgi|Sorbi1|5054415|Sb03g046410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]