SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5XW22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5XW22
Domain Number 1 Region: 99-144
Classification Level Classification E-value
Superfamily PA domain 0.00000000103
Family PA domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C5XW22
Sequence length 547
Comment (tr|C5XW22|C5XW22_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EES06047.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3004G351100 OC=Sorghum.
Sequence
MARRALEPAAVLLVLAALAAVAAGGDIRHQDDDAPKIPGCSNDFVLVKVRTWINQKDKIE
FVGVGARFGPKIESKEKQSNWTNLLLPDTSDCCTPPKEKVAGDILLVERGNCTFTTKARV
AESAGASAIIIINDKQELYKMVCETNETNLDIGIPAVLLPKDAGSSLERSLSSGEVLVEL
YSPDRPLVDTAEVFLWLMAVGTILCASYWSAWSAREADIEQEKLLKDGHEVPPNFEAGGS
SGMVEINMVSAILFVVIASCFLITLYKKMSHWFVELLVVIFCIGGVEGLQTCLVGLLSMS
RWFKPAAGSFVKVPFFGAVSYLTLAVCPFCIVFAVLWGVYRRLSFAWIGQDILGITLIVT
VIQIVRIPNLKVGSALLSCAFLYDIFWVFISKMIFHESVMIVVARGDKTDEDGVPMLLKI
PRMFDPWGGYSIIGFGDILLPGLLVAFALRYDWAAKKTLQSGYFLWSMVAYGSGLLITYV
ALNLMDGHGQPALLYIVPFTIGTFLALGMKRGELRNLWTKGQPERVCTHMHTHPSPKDSP
VAVSSTS
Download sequence
Identical sequences C5XW22
XP_002453071.1.57931 jgi|Sorbi1|5056163|Sb04g037790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]