SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C5Y4M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C5Y4M3
Domain Number 1 Region: 93-170,275-302
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000394
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Weak hits

Sequence:  C5Y4M3
Domain Number - Region: 378-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C5Y4M3
Sequence length 511
Comment (tr|C5Y4M3|C5Y4M3_SORBI) Uncharacterized protein {ECO:0000313|EMBL:EES07983.1} KW=Complete proteome; Reference proteome OX=4558 OS=Sorghum bicolor (Sorghum) (Sorghum vulgare). GN=SORBI_3005G035900 OC=Sorghum.
Sequence
MRRGKGDDPAIAAAAAIAVLCVTSAVLLVNGATEGEELTTQLSNGFTAAHAAGAPVPFEP
VLYAASGAFAFGFLRVGAASLDLAVVHLPSSFPVWRATPARLGNWSRPATLTFDDGSLVL
LTDHDDNDDVLWRTVDAVGDVVVLLESSNLVVRRYERTVPEWESFDHPSDTLVLGQNFTG
SSPPLVSANRRFALRLGKTYMALHMEFYGGGRTKMTPTYWRHTALMANPENATEPPVYGR
LDARGFFGLYLDGGRGDERVDVLSFDTFVQNLTGVFRRMTLDDDGNLRAYYWASGSKAWT
SDYRAISERCELPTPCGAYGLCVPGKAECQCLLDNSTRAAAPSCHAEETADLCAGSGQQL
GFEVVRRKRVSVAYKEELPFETNRTAAECEAACAANCSCWAALHSGASGYCYLIDFPVET
LVYEADDRKVGYFKVRKSPPASTTTGMSPDVAAVTAALSLVLVGLAMAGVCIGYQIRERR
ERRRAGMEHELVPVTYKDLRSMDSSNNSFRA
Download sequence
Identical sequences C5Y4M3
jgi|Sorbi1|5056353|Sb05g003000 4558.Sb05g003000.1 XP_002448995.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]