SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6A4V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6A4V4
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-36
Family AlaX-like 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6A4V4
Sequence length 148
Comment (tr|C6A4V4|C6A4V4_THESM) Alanyl-tRNA synthetase-like protein {ECO:0000313|EMBL:ACS90649.1} KW=Complete proteome; Reference proteome OX=604354 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597). GN=TSIB_1598 OC=Thermococcus.
Sequence
MEVKTHTALHVLKGAVVKVLGEEAKWTAAVYVNGNHGRLTIKFNRKPTKEEIAMIEEFAN
RKIEENAPIKVHELPREEAESRFGEDMYDLFPIPEEIRTLKVVVIEDWNINACNKEHTKT
TGEIGQIKIRKVRFRKVKELLEISFDVV
Download sequence
Identical sequences A0A101EM70 A0A117L6Q7 C6A4V4
WP_015849865.1.69891 604354.TSIB_1598 gi|242399573|ref|YP_002994998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]