SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6B8Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6B8Y2
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000366
Family Bactericidal permeability-increasing protein, BPI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6B8Y2
Sequence length 159
Comment (tr|C6B8Y2|C6B8Y2_RHILS) Uncharacterized protein {ECO:0000313|EMBL:ACS60370.1} KW=Complete proteome OX=395491 OS=Rhizobium leguminosarum bv. trifolii (strain WSM1325). GN=Rleg_5554 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MRNCLGLLTAGVFLLQPCSFAKAQAPNALERAIGDVQPCRSLKTKVSSFGISVEVGVDKL
DSVKIENLQLSVNGDTAEASARGTLACKTSDEALVEGGFSATAEVRLKIDLSTCKTTDTS
IEIVKTGGRFGDVVKGLETQISGVLRQSLEKNLAKLCQK
Download sequence
Identical sequences C6B8Y2
gi|241518293|ref|YP_002978921.1| WP_012760308.1.14669 gi|241518293|ref|YP_002978921.1|NC_012853 395491.Rleg_5554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]