SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6K3Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6K3Q7
Domain Number 1 Region: 2-256,288-342
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.18e-37
Family Aclacinomycin methylesterase RdmC 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6K3Q7
Sequence length 376
Comment (tr|C6K3Q7|C6K3Q7_9TRYP) Putative hydrolase-like protein {ECO:0000313|EMBL:ACS87846.1} OX=672011 OS=Crithidia sp. ATCC 30255. GN=CDFL6B24_04 OC=Leishmaniinae; Crithidia.
Sequence
MGLASPGLFWDDRWCTSLALAGPYFVVRFDNRDVGCSTHLDEKADPKDATTAAPGSTSYM
RFAYAVLRPGKRTIPEVYTLMDLAADAFGLLDALHVTACHLVGSSMGGTVIQCMAIAHPE
RVLSLTLMSTHSSSPQTQWPSLRDMMSFISLMPKSTSAKYAARIAGAASSEERQRLCAER
DAERVHVYAVSFTKLLERLAGDTKKYPFDRAAAQRQMSRIFRRSLYVNGGPRQFLALLNA
PSRDDDLRRCITSVAASNNSGAAKTTTSSAGGAAAAKSSSAVSPMYVPTIIIQGDHDPLV
PAANAKHLAAVIPGSRLYMVEGMGHTLIPSLRDTYIRLIRENIRAGEAAAHTPARKAAQA
AAARKPKATPKISSKL
Download sequence
Identical sequences C6K3Q7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]