SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6LWX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C6LWX0
Domain Number - Region: 25-59
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6LWX0
Sequence length 66
Comment (tr|C6LWX0|C6LWX0_GIAIB) Uncharacterized protein {ECO:0000313|EMBL:EES99539.1} KW=Complete proteome OX=598745 OS=lamblia). GN=GL50581_3284 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MEQPPANPSSAAVHDRISLEAMPTRAYLDETVVPIVMQGLAALVQERPENPVQFLGEFLL
LHSQKK
Download sequence
Identical sequences A0A132P1E5 C6LWX0 V6U500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]