SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6WJZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6WJZ9
Domain Number 1 Region: 1-389
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.19e-61
Family Gtf glycosyltransferase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6WJZ9
Sequence length 411
Comment (tr|C6WJZ9|C6WJZ9_ACTMD) Uncharacterized protein {ECO:0000313|EMBL:ACU38212.1} KW=Complete proteome; Reference proteome OX=446462 OS=3971). GN=Amir_4361 OC=Actinosynnema.
Sequence
MRVLFTALPAASRFPHLVPLAWALRAAGHELRVATRPGGTGAVTGAGLTPVVVGPPAPAR
PAPARPAATPAPDDDLPGLALLDGPVDALAARLPPVDDAVDDLVAFGRRWRPDLVVWDAS
DYSGPVLAQVLGAPSARVLLGLDLVGWRRATPDRPDPLAALLGGALARHGAALTDEVALG
SVTLDQLPPWMRLPVDHDHLPVRHVPHNAPAIVHGWLRAGPTGPRICVLPGPVADSAERD
RARVLLRGAARLGVEVVTALPAGEAARIGHLPDHVRLHDPLPLHELLPTCAALVHRGDAA
AEGAAIASAVPQLVVPAPLWDEPRRADLLAARGAALVVRRDRLTEGAVADALTRLLGEPA
FAEAAAVVHRETLAVPSPHDLVPALEALVTERSARSVPAARPARPARAPVR
Download sequence
Identical sequences C6WJZ9
gi|256378398|ref|YP_003102058.1| 446462.Amir_4361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]