SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6WPG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6WPG6
Domain Number 1 Region: 1-431
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.26e-82
Family Gtf glycosyltransferase 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C6WPG6
Sequence length 443
Comment (tr|C6WPG6|C6WPG6_ACTMD) Sterol 3-beta-glucosyltransferase {ECO:0000313|EMBL:ACU38668.1} KW=Complete proteome; Reference proteome OX=446462 OS=3971). GN=Amir_4841 OC=Actinosynnema.
Sequence
MRTLIYAWGSRGDVQPYLALARALNRAGHDAVLAGPERFAGLAQEHGVEFHPRDQGLLDF
YVQDEDISEWLRDQGAVRRGKMALRKRALNKLAGEFFRRFPRMLADISSAGERGADLVVQ
SYEELPFEQGHHVAEKLGAPVVLATLFPNYVPSAHYPAKFLPADRTFPRVLRRLSHLPGA
LLPPIGKAGVDAWRSDVLGLPARRNQHDRLRRPDGGRVPVLHGFSPHLVPPAPDWPAWVF
TTGFWFLPPRADYSPPAELAAFLDGGEPPVCVTLGTVRGMDPVEAGRLVVEAVRLAGVRA
VVVRASGSLEVADPPPGVLVVDDVPYPWLFPRTAAVVSAAGVGTVNEALRVGVPQVTCPV
HNEQLMWAVLARDAGVAGEPLRNRDLTPARLADAIRAVLADRSTGDRARALARVVDAERG
AENAVELLERLHARRDKLTAPVR
Download sequence
Identical sequences C6WPG6
446462.Amir_4841 gi|256378854|ref|YP_003102514.1| WP_015803555.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]