SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6XG26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6XG26
Domain Number 1 Region: 18-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.58e-49
Family NQO2-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C6XG26
Sequence length 218
Comment (tr|C6XG26|C6XG26_LIBAP) NADH-quinone oxidoreductase, E subunit {ECO:0000313|EMBL:ACT57329.1} KW=Complete proteome OX=537021 OS=Liberibacter asiaticus (strain psy62). GN=CLIBASIA_03755 OC=Rhizobiaceae; Liberibacter.
Sequence
MSVRRLAEEEFQPSSFSFSEESAIWVNEVISRYPPSRCQSAVIPLLMRAQEQEGWVSRAA
IEVVANILDMAYIRVLEIATFYTQFQLSPVGTRAHVQVCGTTPCMLRGCEKLIEVCRNKI
HQKPLHRNSDGTLSWEEVECQGACVNAPMVMIGKDTYEDLTPERLEEIIDAFSTGQGDTI
RPGPQIDRISSAPAGGLTSLLDNNSKKRGKKKKDDKIS
Download sequence
Identical sequences C6XG26
gi|254780856|ref|YP_003065269.1| gi|470205215|ref|YP_007599313.1| WP_015452689.1.15810 WP_015452689.1.15976 WP_015452689.1.16756 WP_015452689.1.18731 WP_015452689.1.3509 WP_015452689.1.50033 WP_015452689.1.77054 WP_015452689.1.78654 WP_015452689.1.94010 537021.CLIBASIA_03755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]