SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C6XGD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C6XGD8
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-34
Family Thioltransferase 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C6XGD8
Sequence length 106
Comment (tr|C6XGD8|C6XGD8_LIBAP) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome OX=537021 OS=Liberibacter asiaticus (strain psy62). GN=CLIBASIA_04345 OC=Rhizobiaceae; Liberibacter.
Sequence
MNSSVNSIIQNEIKKNDVVLFMKGTPTSPRCGFSGKVVQVLDSLGVSYKGIDVLADDALR
QSIKEYSNWPTIPQLYVKGDFIGGCDIVCEMFESGELHEILSIDRI
Download sequence
Identical sequences C6XGD8
gi|470205326|ref|YP_007599424.1| 537021.CLIBASIA_04345 gi|254780968|ref|YP_003065381.1| WP_015452799.1.15810 WP_015452799.1.15976 WP_015452799.1.16756 WP_015452799.1.18731 WP_015452799.1.3509 WP_015452799.1.50033 WP_015452799.1.77054 WP_015452799.1.78654 WP_015452799.1.79050 WP_015452799.1.94010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]